PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01014.1.g00070.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 207aa    MW: 23138.7 Da    PI: 9.6086
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01014.1.g00070.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.93.5e-201664149
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                                  kri+ +  rqv fskRr+g++KKA+ELS+LC+a v  ++fs+ gk +++
  Zpz_sc01014.1.g00070.1.sm.mk 16 KRINCTAARQVCFSKRRQGLFKKASELSILCGAMVGFVVFSPAGKPFTF 64
                                  68889999*************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.936868IPR002100Transcription factor, MADS-box
SMARTSM004325.7E-29867IPR002100Transcription factor, MADS-box
CDDcd002655.12E-33976No hitNo description
SuperFamilySSF554553.27E-26983IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-191030IPR002100Transcription factor, MADS-box
PfamPF003195.6E-241764IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-193045IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-194566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MVKGRASLGR QKIEIKRINC TAARQVCFSK RRQGLFKKAS ELSILCGAMV GFVVFSPAGK  60
PFTFGSPSIK AVIDKHFRTL GNRSSPKVDH EIHNVSGVET TVLLERKELE KSLEAKKIRT  120
KKIDEEIVEK DCGYLMHYTS ADISGLGPYE LQEIYNNLEA IKYVLMGMHS QMHQEKPAVR  180
VDVGDSFASG VQEFAGFMDH RSNPFNG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4AJ953e-45K4AJ95_SETIT; Uncharacterized protein
STRINGSi038960m8e-45(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-25AGAMOUS-like 61